PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.42201s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 153aa    MW: 16992.9 Da    PI: 8.1904
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.42201s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-094401147
                          HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
  Araha.42201s0001.1.p  4 QFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 40
                          79999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.522145IPR017930Myb domain
CDDcd001672.70E-7341No hitNo description
TIGRFAMsTIGR015572.2E-11344IPR006447Myb domain, plants
SuperFamilySSF466891.25E-10344IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-7440IPR009057Homeodomain-like
PfamPF002494.0E-7440IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MCRQFLMGLK KYGKGDWRNI ARNFVTTRTP TQVASHAQKY FIRQVNGGKD KRRSSIHDIT  60
TVNIPDSPDA AAADNATANA PCSPPSIVGS QRETSEWEGQ TLYDETTAAF YNQNAFSETL  120
LGMSSTPYMA KLQEQSFLNA SQFESYNAYL QM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0030280.0AC003028.3 Arabidopsis thaliana chromosome 2 clone F16M14 map ve018, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002879727.11e-106myb family transcription factor
SwissprotQ8S9H71e-37DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD7LKT01e-106D7LKT0_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.4__1876__AT2G38090.11e-106(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-90MYB family protein